Lineage for d4oiva_ (4oiv A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2728284Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2728285Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2728286Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2729635Protein automated matches [190059] (14 species)
    not a true protein
  7. 2729657Species Human (Homo sapiens) [TaxId:9606] [187214] (171 PDB entries)
  8. 2729693Domain d4oiva_: 4oiv A: [270306]
    automated match to d3p88a_
    complexed with xx9

Details for d4oiva_

PDB Entry: 4oiv (more details), 1.7 Å

PDB Description: structural basis for small molecule ndb as a selective antagonist of fxr
PDB Compounds: (A:) Bile acid receptor

SCOPe Domain Sequences for d4oiva_:

Sequence, based on SEQRES records: (download)

>d4oiva_ a.123.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eltpdqqtllhfimdsynkqrmpqeitnkilkeefsaeenfliltematnhvqvlveftk
klpgfqtldhedqiallkgsaveamflrsaeifnkklpsghsdlleerirnsgisdeyit
pmfsfyksigelkmtqeeyalltaivilspdrqyikdreaveklqeplldvlqklckihq
penpqhfaellgrltelrtfnhhhaemlmswrvndhkftplleeiw

Sequence, based on observed residues (ATOM records): (download)

>d4oiva_ a.123.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eltpdqqtllhfimdsynksaeenfliltematnhvqvlveftkklpgfqtldhedqial
lkgsaveamflrsaeifnkklpsghsdlleerirnsgisdeyitpmfsfyksigelkmtq
eeyalltaivilspdrqyikdreaveklqeplldvlqklckihqpenpqhfaellgrlte
lrtfnhhhaemlmswrvndhkftplleeiw

SCOPe Domain Coordinates for d4oiva_:

Click to download the PDB-style file with coordinates for d4oiva_.
(The format of our PDB-style files is described here.)

Timeline for d4oiva_: