Class a: All alpha proteins [46456] (289 folds) |
Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily) multihelical; 3 layers or orthogonally packed helices |
Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) |
Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins) |
Protein automated matches [190059] (14 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187214] (212 PDB entries) |
Domain d4oivb_: 4oiv B: [270305] automated match to d3p88a_ complexed with xx9 |
PDB Entry: 4oiv (more details), 1.7 Å
SCOPe Domain Sequences for d4oivb_:
Sequence, based on SEQRES records: (download)
>d4oivb_ a.123.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} eltpdqqtllhfimdsynkqrmpqeitnkilkeefsaeenfliltematnhvqvlveftk klpgfqtldhedqiallkgsaveamflrsaeifnkklpsghsdlleerirnsgisdeyit pmfsfyksigelkmtqeeyalltaivilspdrqyikdreaveklqeplldvlqklckihq penpqhfaellgrltelrtfnhhhaemlmswrvndhkftplleeiw
>d4oivb_ a.123.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} eltpdqqtllhfimdsynkqrmpqeitnkilkeefsaeenfliltematnhvqvlveftk klpgfqtldhedqiallkgsaveamflrsaeifnsdlleerirnsgisdeyitpmfsfyk sigelkmtqeeyalltaivilspdrqyikdreaveklqeplldvlqklckihqpenpqhf aellgrltelrtfnhhhaemlmswrvndhktplleeiw
Timeline for d4oivb_: