SCOPe 2.07: Domain d4oivb_: 4oiv B:

Lineage for d4oivb_ (4oiv B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
   multihelical; 3 layers or orthogonally packed helices

4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families)

5. Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)

6. Protein automated matches [190059] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187214] (212 PDB entries)

8. Domain d4oivb_: 4oiv B: [270305]
   automated match to d3p88a_
   complexed with xx9

Details for d4oivb_

PDB Entry: 4oiv, 1.7 Å

PDB Description: structural basis for small molecule ndb as a selective antagonist of fxr

PDB Compounds: (B:) Bile acid receptor

SCOPe Domain Sequences for d4oivb_:

Sequence, based on SEQRES records:

>d4oivb_ a.123.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eltpdqqtllhfimdsynkqrmpqeitnkilkeefsaeenfliltematnhvqvlveftk
klpgfqtldhedqiallkgsaveamflrsaeifnkklpsghsdlleerirnsgisdeyit
pmfsfyksigelkmtqeeyalltaivilspdrqyikdreaveklqeplldvlqklckihq
penpqhfaellgrltelrtfnhhhaemlmswrvndhkftplleeiw

Sequence, based on observed residues (ATOM records):

>d4oivb_ a.123.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eltpdqqtllhfimdsynkqrmpqeitnkilkeefsaeenfliltematnhvqvlveftk
klpgfqtldhedqiallkgsaveamflrsaeifnsdlleerirnsgisdeyitpmfsfyk
sigelkmtqeeyalltaivilspdrqyikdreaveklqeplldvlqklckihqpenpqhf
aellgrltelrtfnhhhaemlmswrvndhktplleeiw

Timeline for d4oivb_:

• d4oivb_ first appeared in SCOPe 2.05
  
• d4oivb_ appears in SCOPe 2.06
  
• d4oivb_ appears in the current release, SCOPe 2.08