Lineage for d4oivb_ (4oiv B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2335122Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2335123Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2335124Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2336144Protein automated matches [190059] (14 species)
    not a true protein
  7. 2336166Species Human (Homo sapiens) [TaxId:9606] [187214] (155 PDB entries)
  8. 2336207Domain d4oivb_: 4oiv B: [270305]
    automated match to d3p88a_
    complexed with xx9

Details for d4oivb_

PDB Entry: 4oiv (more details), 1.7 Å

PDB Description: structural basis for small molecule ndb as a selective antagonist of fxr
PDB Compounds: (B:) Bile acid receptor

SCOPe Domain Sequences for d4oivb_:

Sequence, based on SEQRES records: (download)

>d4oivb_ a.123.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eltpdqqtllhfimdsynkqrmpqeitnkilkeefsaeenfliltematnhvqvlveftk
klpgfqtldhedqiallkgsaveamflrsaeifnkklpsghsdlleerirnsgisdeyit
pmfsfyksigelkmtqeeyalltaivilspdrqyikdreaveklqeplldvlqklckihq
penpqhfaellgrltelrtfnhhhaemlmswrvndhkftplleeiw

Sequence, based on observed residues (ATOM records): (download)

>d4oivb_ a.123.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eltpdqqtllhfimdsynkqrmpqeitnkilkeefsaeenfliltematnhvqvlveftk
klpgfqtldhedqiallkgsaveamflrsaeifnsdlleerirnsgisdeyitpmfsfyk
sigelkmtqeeyalltaivilspdrqyikdreaveklqeplldvlqklckihqpenpqhf
aellgrltelrtfnhhhaemlmswrvndhktplleeiw

SCOPe Domain Coordinates for d4oivb_:

Click to download the PDB-style file with coordinates for d4oivb_.
(The format of our PDB-style files is described here.)

Timeline for d4oivb_: