Lineage for d4oqfa2 (4oqf A:270-331)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1904179Fold d.48: Anti-LPS factor/recA domain [54751] (2 superfamilies)
    alpha-beta(3)-alpha(2); 2 layers, alpha/beta
  4. 1904180Superfamily d.48.1: RecA protein, C-terminal domain [54752] (2 families) (S)
  5. 1904210Family d.48.1.0: automated matches [227236] (1 protein)
    not a true family
  6. 1904211Protein automated matches [226990] (3 species)
    not a true protein
  7. 1904225Species Mycobacterium tuberculosis [TaxId:1773] [270303] (16 PDB entries)
  8. 1904237Domain d4oqfa2: 4oqf A:270-331 [270304]
    Other proteins in same PDB: d4oqfa1
    automated match to d1ubfa2
    complexed with edo, gol

Details for d4oqfa2

PDB Entry: 4oqf (more details), 2.8 Å

PDB Description: mycobacterium tuberculosis reca glycerol bound low temperature structure iib-sr
PDB Compounds: (A:) Protein recA

SCOPe Domain Sequences for d4oqfa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4oqfa2 d.48.1.0 (A:270-331) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
sregslidmgvdqglirksgawftyegeqlgqgkenarnflvenadvadeiekkikeklg
ig

SCOPe Domain Coordinates for d4oqfa2:

Click to download the PDB-style file with coordinates for d4oqfa2.
(The format of our PDB-style files is described here.)

Timeline for d4oqfa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4oqfa1