SCOPe 2.08: Domain d4mpwa_: 4mpw A:

Lineage for d4mpwa_ (4mpw A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein beta-Tryptase [50546] (1 species)
   ring-like tetramer with active sites facing a central pore

7. Species Human (Homo sapiens) [TaxId:9606] [50547] (22 PDB entries)

8. Domain d4mpwa_: 4mpw A: [270298]
   automated match to d1a0la_
   complexed with 2aj, act, cl, pge

Details for d4mpwa_

PDB Entry: 4mpw, 1.95 Å

PDB Description: human beta-tryptase co-crystal structure with [(1,1,3,3- tetramethyldisiloxane-1,3-diyl)di-1-benzofuran-3,5-diyl]bis({4-[3- (aminomethyl)phenyl]piperidin-1-yl}methanone)

PDB Compounds: (A:) tryptase alpha/beta-1

SCOPe Domain Sequences for d4mpwa_:

Sequence; same for both SEQRES and ATOM records:

>d4mpwa_ b.47.1.2 (A:) beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]}
ivggqeaprskwpwqvslrvhgpywmhfcggslihpqwvltaahcvgpdvkdlaalrvql
reqhlyyqdqllpvsriivhpqfytaqigadialleleepvkvsshvhtvtlppasetfp
pgmpcwvtgwgdvdnderlpppfplkqvkvpimenhicdakyhlgaytgddvrivrddml
cagntrrdscqgdsggplvckvngtwlqagvvswgegcaqpnrpgiytrvtyyldwihhy
vpk

Timeline for d4mpwa_:

• d4mpwa_ first appeared in SCOPe 2.05
  
• d4mpwa_ appears in SCOPe 2.07