Lineage for d2mzda_ (2mzd A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3038292Fold g.53: TAZ domain [57932] (1 superfamily)
    all-alpha fold; Zn-binding sites are in the loops connecting helices
  4. 3038293Superfamily g.53.1: TAZ domain [57933] (1 family) (S)
    automatically mapped to Pfam PF02135
  5. 3038294Family g.53.1.1: TAZ domain [57934] (2 proteins)
  6. 3038308Protein automated matches [254574] (2 species)
    not a true protein
  7. 3038309Species Human (Homo sapiens) [TaxId:9606] [255328] (3 PDB entries)
  8. 3038312Domain d2mzda_: 2mzd A: [270284]
    automated match to d2mh0b_

Details for d2mzda_

PDB Entry: 2mzd (more details)

PDB Description: characterization of the p300 taz2-p53 tad2 complex and comparison with the p300 taz2-p53 tad1 complex
PDB Compounds: (A:) Histone acetyltransferase p300

SCOPe Domain Sequences for d2mzda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mzda_ g.53.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
atqspgdsrrlsiqraiqslvhaaqcrnancslpscqkmkrvvqhtkgckrktnggcpic
kqlialaayhakhcqenkcpvpfclnikqk

SCOPe Domain Coordinates for d2mzda_:

Click to download the PDB-style file with coordinates for d2mzda_.
(The format of our PDB-style files is described here.)

Timeline for d2mzda_: