![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.53: TAZ domain [57932] (1 superfamily) all-alpha fold; Zn-binding sites are in the loops connecting helices |
![]() | Superfamily g.53.1: TAZ domain [57933] (1 family) ![]() automatically mapped to Pfam PF02135 |
![]() | Family g.53.1.1: TAZ domain [57934] (2 proteins) |
![]() | Protein automated matches [254574] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [255328] (3 PDB entries) |
![]() | Domain d2mzda_: 2mzd A: [270284] automated match to d2mh0b_ |
PDB Entry: 2mzd (more details)
SCOPe Domain Sequences for d2mzda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2mzda_ g.53.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} atqspgdsrrlsiqraiqslvhaaqcrnancslpscqkmkrvvqhtkgckrktnggcpic kqlialaayhakhcqenkcpvpfclnikqk
Timeline for d2mzda_: