SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4mpja2 (4mpj A:182-341)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2107255Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 2107256Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 2107283Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (8 protein domains)
    N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold
  6. 2107307Protein Benzoylformate decarboxylase [52482] (1 species)
  7. 2107308Species Pseudomonas putida [TaxId:303] [52483] (41 PDB entries)
    Uniprot P20906
  8. 2107359Domain d4mpja2: 4mpj A:182-341 [270280]
    Other proteins in same PDB: d4mpja1, d4mpja3
    automated match to d1q6za1
    complexed with ca, cl, gol, mg, tpp; mutant

Details for d4mpja2

PDB Entry: 4mpj (more details), 1.5 Å

PDB Description: phosphorylation of an active site threonine in the benzyolformate decarboxylase mutant s26t by phosphonate inactivation
PDB Compounds: (A:) Benzoylformate decarboxylase

SCOPe Domain Sequences for d4mpja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mpja2 c.31.1.3 (A:182-341) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]}
svrlndqdldilvkalnsasnpaivlgpdvdaananadcvmlaerlkapvwvapsaprcp
fptrhpcfrglmpagiaaisqlleghdvvlvigapvfryhqydpgqylkpgtrlisvtcd
pleaarapmgdaivadigamasalanlveessrqlptaap

SCOPe Domain Coordinates for d4mpja2:

Click to download the PDB-style file with coordinates for d4mpja2.
(The format of our PDB-style files is described here.)

Timeline for d4mpja2: