![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
![]() | Superfamily c.61.1: PRTase-like [53271] (3 families) ![]() |
![]() | Family c.61.1.0: automated matches [191528] (1 protein) not a true family |
![]() | Protein automated matches [190891] (38 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [225156] (13 PDB entries) |
![]() | Domain d4m0ua1: 4m0u A:3-160 [270263] automated match to d3s5ja1 complexed with so4; mutant |
PDB Entry: 4m0u (more details), 2.74 Å
SCOPe Domain Sequences for d4m0ua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4m0ua1 c.61.1.0 (A:3-160) automated matches {Human (Homo sapiens) [TaxId: 9606]} nikifsgsshqdlsqkiadrlglelgkvvtkkfsnqetcveigesvrgedvyivqsgcge indnlmelliminackiasasrvtavipcfpyarqdkkdksrapisaklvanmlsvagad hiitmdlhaspiqgffdipvdnlyaepavlkwirenis
Timeline for d4m0ua1: