Lineage for d4lznb1 (4lzn B:3-160)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1863464Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 1863465Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 1863901Family c.61.1.0: automated matches [191528] (1 protein)
    not a true family
  6. 1863902Protein automated matches [190891] (25 species)
    not a true protein
  7. 1863980Species Human (Homo sapiens) [TaxId:9606] [225156] (13 PDB entries)
  8. 1864019Domain d4lznb1: 4lzn B:3-160 [270257]
    automated match to d3s5ja1
    complexed with so4; mutant

Details for d4lznb1

PDB Entry: 4lzn (more details), 2.14 Å

PDB Description: crystal structure of human prs1 d65n mutant
PDB Compounds: (B:) Ribose-phosphate pyrophosphokinase 1

SCOPe Domain Sequences for d4lznb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lznb1 c.61.1.0 (B:3-160) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nikifsgsshqdlsqkiadrlglelgkvvtkkfsnqetcveigesvrgedvyivqsgcge
innnlmelliminackiasasrvtavipcfpyarqdkkdksrapisaklvanmlsvagad
hiitmdlhasqiqgffdipvdnlyaepavlkwirenis

SCOPe Domain Coordinates for d4lznb1:

Click to download the PDB-style file with coordinates for d4lznb1.
(The format of our PDB-style files is described here.)

Timeline for d4lznb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4lznb2