Lineage for d4lzna2 (4lzn A:161-313)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1863464Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 1863465Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 1863901Family c.61.1.0: automated matches [191528] (1 protein)
    not a true family
  6. 1863902Protein automated matches [190891] (25 species)
    not a true protein
  7. 1863980Species Human (Homo sapiens) [TaxId:9606] [225156] (13 PDB entries)
  8. 1864018Domain d4lzna2: 4lzn A:161-313 [270256]
    automated match to d4f8ea2
    complexed with so4; mutant

Details for d4lzna2

PDB Entry: 4lzn (more details), 2.14 Å

PDB Description: crystal structure of human prs1 d65n mutant
PDB Compounds: (A:) Ribose-phosphate pyrophosphokinase 1

SCOPe Domain Sequences for d4lzna2:

Sequence, based on SEQRES records: (download)

>d4lzna2 c.61.1.0 (A:161-313) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ewrnctivspdaggakrvtsiadrlnvdfalihkerkkanevdrmvlvgdvkdrvailvd
dmadtcgtichaadkllsagatrvyailthgifsgpaisrinnacfeavvvtntipqedk
mkhcskiqvidismilaeairrthngesvsylf

Sequence, based on observed residues (ATOM records): (download)

>d4lzna2 c.61.1.0 (A:161-313) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ewrnctivspdaggakrvtsiadrlnvdfalihkedrmvlvgdvkdrvailvddmadtcg
tichaadkllsagatrvyailthgifsgpaisrinnacfeavvvtntipqedkmkhcski
qvidismilaeairrthngesvsylf

SCOPe Domain Coordinates for d4lzna2:

Click to download the PDB-style file with coordinates for d4lzna2.
(The format of our PDB-style files is described here.)

Timeline for d4lzna2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4lzna1