SCOPe 2.05: Domain d4lyga1: 4lyg A:3-160

Lineage for d4lyga1 (4lyg A:3-160)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.0: automated matches [191528] (1 protein)
   not a true family

6. Protein automated matches [190891] (25 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225156] (13 PDB entries)

8. Domain d4lyga1: 4lyg A:3-160 [270251]
   automated match to d3s5ja1
   complexed with so4; mutant

Details for d4lyga1

PDB Entry: 4lyg, 3 Å

PDB Description: crystal structure of human prs1 e43t mutant

PDB Compounds: (A:) Ribose-phosphate pyrophosphokinase 1

SCOPe Domain Sequences for d4lyga1:

Sequence; same for both SEQRES and ATOM records:

>d4lyga1 c.61.1.0 (A:3-160) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nikifsgsshqdlsqkiadrlglelgkvvtkkfsnqetcvtigesvrgedvyivqsgcge
indnlmelliminackiasasrvtavipcfpyarqdkkdksrapisaklvanmlsvagad
hiitmdlhasqiqgffdipvdnlyaepavlkwirenis

Timeline for d4lyga1:

• d4lyga1 is new in SCOPe 2.05-stable
  
• d4lyga1 appears in SCOPe 2.06
  
• d4lyga1 appears in the current release, SCOPe 2.08