Lineage for d1vzva_ (1vzv A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2803993Fold b.57: Herpes virus serine proteinase, assemblin [50788] (1 superfamily)
    core: barrel, closed; n=7, S=8; complex topology
  4. 2803994Superfamily b.57.1: Herpes virus serine proteinase, assemblin [50789] (2 families) (S)
    automatically mapped to Pfam PF00716
  5. 2803995Family b.57.1.1: Herpes virus serine proteinase, assemblin [50790] (5 proteins)
  6. 2804048Protein VZV protease [50797] (1 species)
  7. 2804049Species Varicella-Zoster virus [TaxId:10335] [50798] (1 PDB entry)
  8. 2804050Domain d1vzva_: 1vzv A: [27025]
    missing some secondary structures that made up less than one-third of the common domain

Details for d1vzva_

PDB Entry: 1vzv (more details), 3 Å

PDB Description: structure of varicella-zoster virus protease
PDB Compounds: (A:) varicella-zoster virus protease

SCOPe Domain Sequences for d1vzva_:

Sequence, based on SEQRES records: (download)

>d1vzva_ b.57.1.1 (A:) VZV protease {Varicella-Zoster virus [TaxId: 10335]}
ealyvagylalyskdegelnitpeivrsalpptskipinidhrkdcvvgeviaiiedirg
pfflgivrcpqlhavlfeaahsnffgnrdsvlspleralylvtnylpsvslsskrlspne
ipdgnffthvalcvvgrrvgtvvnydctpessiepfrvlsmeskarllslvkdyaglnkv
wkvsedklakvllstavnnmllrdrwdvvakrrreagimgh

Sequence, based on observed residues (ATOM records): (download)

>d1vzva_ b.57.1.1 (A:) VZV protease {Varicella-Zoster virus [TaxId: 10335]}
ealyvagylalyskdegelnitpeivrsalpptskipinidhrkdcvvgeviaiiedirg
pfflgivrcpqlhavlfeaahsnffgnrdsvlspleralylvtnylpsvslsskrlfthv
alcvvgrrvgtvvnydctpessiepfrvlsmeskarllslvkdyaglnkvwkvsedklak
vllstavnnmllrdrwdvvakrrreagimgh

SCOPe Domain Coordinates for d1vzva_:

Click to download the PDB-style file with coordinates for d1vzva_.
(The format of our PDB-style files is described here.)

Timeline for d1vzva_: