![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.28: Peptide methionine sulfoxide reductase [55068] (2 families) ![]() common fold is elaborated with additional secondary structures |
![]() | Family d.58.28.0: automated matches [233250] (1 protein) not a true family |
![]() | Protein automated matches [233251] (2 species) not a true protein |
![]() | Species Corynebacterium diphtheriae [TaxId:257309] [270245] (1 PDB entry) |
![]() | Domain d4d7lc_: 4d7l C: [270248] automated match to d2l90a_ complexed with cac, pge, so4 |
PDB Entry: 4d7l (more details), 1.9 Å
SCOPe Domain Sequences for d4d7lc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4d7lc_ d.58.28.0 (C:) automated matches {Corynebacterium diphtheriae [TaxId: 257309]} aprlveekdalkggphpvlpnpqphavlgtlrgqpgtetiyigigcywgaeklfwetpgv vytsvgfaggitpnptyretctgrtnhteivevvydptqvtfdelvvkameahdptqgyr qgndtgtqyrsaiytagpnaeqqaqrareivehyapklaaaglgritteilplastpage yymaedehqqylhknplgycphhstgvacgipe
Timeline for d4d7lc_: