Lineage for d4d7lc_ (4d7l C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2954739Superfamily d.58.28: Peptide methionine sulfoxide reductase [55068] (2 families) (S)
    common fold is elaborated with additional secondary structures
  5. 2954766Family d.58.28.0: automated matches [233250] (1 protein)
    not a true family
  6. 2954767Protein automated matches [233251] (2 species)
    not a true protein
  7. 2954775Species Corynebacterium diphtheriae [TaxId:257309] [270245] (1 PDB entry)
  8. 2954778Domain d4d7lc_: 4d7l C: [270248]
    automated match to d2l90a_
    complexed with cac, pge, so4

Details for d4d7lc_

PDB Entry: 4d7l (more details), 1.9 Å

PDB Description: methionine sulfoxide reductase a of corynebacterium diphtheriae
PDB Compounds: (C:) Peptide methionine sulfoxide reductase msrA

SCOPe Domain Sequences for d4d7lc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4d7lc_ d.58.28.0 (C:) automated matches {Corynebacterium diphtheriae [TaxId: 257309]}
aprlveekdalkggphpvlpnpqphavlgtlrgqpgtetiyigigcywgaeklfwetpgv
vytsvgfaggitpnptyretctgrtnhteivevvydptqvtfdelvvkameahdptqgyr
qgndtgtqyrsaiytagpnaeqqaqrareivehyapklaaaglgritteilplastpage
yymaedehqqylhknplgycphhstgvacgipe

SCOPe Domain Coordinates for d4d7lc_:

Click to download the PDB-style file with coordinates for d4d7lc_.
(The format of our PDB-style files is described here.)

Timeline for d4d7lc_: