Lineage for d4d6va1 (4d6v A:2-313)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2418201Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2418399Superfamily b.69.4: WD40 repeat-like [50978] (4 families) (S)
    also contains 8-bladed propellers
  5. 2418400Family b.69.4.1: WD40-repeat [50979] (17 proteins)
    this is a repeat family; one repeat unit is 1tyq C:201-243 found in domain
  6. 2418575Protein automated matches [190346] (4 species)
    not a true protein
  7. 2418593Species Cryptococcus neoformans [TaxId:235443] [270243] (1 PDB entry)
  8. 2418594Domain d4d6va1: 4d6v A:2-313 [270244]
    Other proteins in same PDB: d4d6va2
    automated match to d4aowa_

Details for d4d6va1

PDB Entry: 4d6v (more details), 2.2 Å

PDB Description: crystal structure of signal transducing protein
PDB Compounds: (A:) g protein beta subunit gib2

SCOPe Domain Sequences for d4d6va1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4d6va1 b.69.4.1 (A:2-313) automated matches {Cryptococcus neoformans [TaxId: 235443]}
aehlmfkgnlaghngwvtaiatssenpdmiltasrdktviawqltrednlygfpkkilhg
hnhfvsdvaissdgqfalssswdhtlrlwdlntglttkkfvghtgdvlsvsfsadnrqiv
sasrdrsiklwntlgeckfdivedghtewvscvrfspnpalpviisagwdktvkvwelsn
cklktthhghtgylntlavspdgslaasggkdgitmlwdlnegkhlysldagdvinalvf
spnrywlcaatassikifdleskslvddlqpdfdglsdkarkpectslawsadgqtlfag
fsdnlvrvwavv

SCOPe Domain Coordinates for d4d6va1:

Click to download the PDB-style file with coordinates for d4d6va1.
(The format of our PDB-style files is described here.)

Timeline for d4d6va1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4d6va2