Lineage for d4d6va_ (4d6v A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1803012Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 1803160Superfamily b.69.4: WD40 repeat-like [50978] (4 families) (S)
    also contains 8-bladed propellers
  5. 1803161Family b.69.4.1: WD40-repeat [50979] (12 proteins)
    this is a repeat family; one repeat unit is 1tyq C:201-243 found in domain
  6. 1803258Protein automated matches [190346] (2 species)
    not a true protein
  7. 1803274Species Cryptococcus neoformans [TaxId:235443] [270243] (1 PDB entry)
  8. 1803275Domain d4d6va_: 4d6v A: [270244]
    automated match to d4aowa_

Details for d4d6va_

PDB Entry: 4d6v (more details), 2.2 Å

PDB Description: crystal structure of signal transducing protein
PDB Compounds: (A:) g protein beta subunit gib2

SCOPe Domain Sequences for d4d6va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4d6va_ b.69.4.1 (A:) automated matches {Cryptococcus neoformans [TaxId: 235443]}
aehlmfkgnlaghngwvtaiatssenpdmiltasrdktviawqltrednlygfpkkilhg
hnhfvsdvaissdgqfalssswdhtlrlwdlntglttkkfvghtgdvlsvsfsadnrqiv
sasrdrsiklwntlgeckfdivedghtewvscvrfspnpalpviisagwdktvkvwelsn
cklktthhghtgylntlavspdgslaasggkdgitmlwdlnegkhlysldagdvinalvf
spnrywlcaatassikifdleskslvddlqpdfdglsdkarkpectslawsadgqtlfag
fsdnlvrvwavvv

SCOPe Domain Coordinates for d4d6va_:

Click to download the PDB-style file with coordinates for d4d6va_.
(The format of our PDB-style files is described here.)

Timeline for d4d6va_: