Lineage for d4d5ia_ (4d5i A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2049732Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2049733Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2051184Family b.29.1.10: Glycosyl hydrolase family 7 catalytic core [49971] (2 proteins)
    contains many insertions in the common fold
    automatically mapped to Pfam PF00840
  6. 2051185Protein Cellobiohydrolase I (cellulase, Endoglucanase I, CBH1) [68900] (7 species)
  7. 2051216Species Trichoderma reesei, Cel7A [TaxId:51453] [68898] (21 PDB entries)
  8. 2051225Domain d4d5ia_: 4d5i A: [270241]
    automated match to d6cela_
    complexed with co, nag, peg

Details for d4d5ia_

PDB Entry: 4d5i (more details), 1.42 Å

PDB Description: hypocrea jecorina cellobiohydrolase cel7a e212q soaked with xylotriose.
PDB Compounds: (A:) Cellulose 1,4-beta-cellobiosidase

SCOPe Domain Sequences for d4d5ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4d5ia_ b.29.1.10 (A:) Cellobiohydrolase I (cellulase, Endoglucanase I, CBH1) {Trichoderma reesei, Cel7A [TaxId: 51453]}
esactlqsethppltwqkcssggtctqqtgsvvidanwrwthatnsstncydgntwsstl
cpdnetcaknccldgaayastygvttsgnslsidfvtqsaqknvgarlylmasdttyqef
tllgnefsfdvdvsqlpcglngalyfvsmdadggvskyptntagakygtgycdsqcprdl
kfingqanvegwepssnnantgigghgsccsqmdiweansisealtphpcttvgqeiceg
dgcggtysdnryggtcdpdgcdwnpyrlgntsfygpgssftldttkkltvvtqfetsgai
nryyvqngvtfqqpnaelgsysgnelnddyctaeeaefggssfsdkggltqfkkatsggm
vlvmslwddyyanmlwldstyptnetsstpgavrgscstssgvpaqvesqspnakvtfsn
ikfgpigstgnpsg

SCOPe Domain Coordinates for d4d5ia_:

Click to download the PDB-style file with coordinates for d4d5ia_.
(The format of our PDB-style files is described here.)

Timeline for d4d5ia_: