Lineage for d4d5qa_ (4d5q A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2779928Family b.29.1.10: Glycosyl hydrolase family 7 catalytic core [49971] (2 proteins)
    contains many insertions in the common fold
    automatically mapped to Pfam PF00840
  6. 2779993Protein automated matches [190170] (17 species)
    not a true protein
  7. 2780052Species Trichoderma reesei [TaxId:334564] [270238] (2 PDB entries)
  8. 2780053Domain d4d5qa_: 4d5q A: [270239]
    automated match to d1egna_
    complexed with co, nag, xyp

Details for d4d5qa_

PDB Entry: 4d5q (more details), 1.68 Å

PDB Description: hypocrea jecorina cel7a (wild type) soaked with xylopentaose.
PDB Compounds: (A:) Cellulose 1,4-beta-cellobiosidase

SCOPe Domain Sequences for d4d5qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4d5qa_ b.29.1.10 (A:) automated matches {Trichoderma reesei [TaxId: 334564]}
esactlqsethppltwqkcssggtctqqtgsvvidanwrwthatnsstncydgntwsstl
cpdnetcaknccldgaayastygvttsgnslsigfvtqsaqknvgarlylmasdttyqef
tllgnefsfdvdvsqlpcglngalyfvsmdadggvskyptntagakygtgycdsqcprdl
kfingqanvegwepssnnantgigghgsccsemdiwqansisealtphpcttvgqeiceg
dgcggtysdnryggtcdpdgcdwnpyrlgntsfygpgssftldttkkltvvtqfetsgai
nryyvqngvtfqqpnaelgsysgnelnddyctaeeaefggssfsdkggltqfkkatsggm
vlvmslwddyyanmlwldstyptnetsstpgavrgscstssgvpaqvesqspnakvtfsn
ikfgpigstgnpsg

SCOPe Domain Coordinates for d4d5qa_:

Click to download the PDB-style file with coordinates for d4d5qa_.
(The format of our PDB-style files is described here.)

Timeline for d4d5qa_: