Lineage for d4cvca_ (4cvc A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2066579Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
    consists of eight 4-stranded beta-sheet motifs; meander
    also found in some members of the WD40-repeat superfamily
  4. 2066580Superfamily b.70.1: Quinoprotein alcohol dehydrogenase-like [50998] (2 families) (S)
  5. 2066633Family b.70.1.0: automated matches [227985] (1 protein)
    not a true family
  6. 2066634Protein automated matches [227986] (3 species)
    not a true protein
  7. 2066641Species Pseudogluconobacter saccharoketogenes [TaxId:133921] [270233] (2 PDB entries)
  8. 2066643Domain d4cvca_: 4cvc A: [270234]
    automated match to d4mh1b_
    complexed with cl, peg, ppi, pqq, zn

Details for d4cvca_

PDB Entry: 4cvc (more details), 1.83 Å

PDB Description: crystal structure of quinone-dependent alcohol dehydrogenase from pseudogluconobacter saccharoketogenenes with zinc in the active site
PDB Compounds: (A:) alcohol dehydrogenase

SCOPe Domain Sequences for d4cvca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cvca_ b.70.1.0 (A:) automated matches {Pseudogluconobacter saccharoketogenes [TaxId: 133921]}
saienfqpvtaddlagknpanwpilrgnyqgwgyspldqinkdnvgdlqlvwsrtmepgs
negaaiayngviflgntndviqaidgktgsliweyrrklpsaskfinslgaakrsialfg
dkvyfvswdnfvvaldaktgklawetnrgqgveegvanssgpivvdgvviagstcqfsgf
gcyvtgtdaesgeelwrntfiprpgeegddtwggapyenrwmtgawgqitydpeldlvyy
gstgagpasevqrgteggtlagtntrfavkpktgevvwkhqtlprdnwdsectfemmvvs
tsvnpdakadgmmsvganvprgetrkvltgvpcktgvawqfdaktgdyfwskatveqnsi
asiddtglvtvnedmilkepgktynycptflggrdwpsagylpksnlyviplsnacydvm
artteatpadvyntdatlvlapgktnmgrvdaidlatgetkwsyetraalydpvlttggd
lvfvggidrdfraldaesgkevwstrlpgavsgyttsysidgrqyvavvsggslggptfg
pttpdvdsasgangiyvfalpe

SCOPe Domain Coordinates for d4cvca_:

Click to download the PDB-style file with coordinates for d4cvca_.
(The format of our PDB-style files is described here.)

Timeline for d4cvca_: