Lineage for d4csra_ (4csr A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1725671Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1725672Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 1726284Family a.22.1.3: TBP-associated factors, TAFs [47134] (14 proteins)
  6. 1726342Protein automated matches [194413] (2 species)
    not a true protein
  7. 1726346Species Homo sapiens [TaxId:9606] [270229] (1 PDB entry)
  8. 1726347Domain d4csra_: 4csr A: [270231]
    automated match to d4g92b_
    complexed with gol

Details for d4csra_

PDB Entry: 4csr (more details), 1.5 Å

PDB Description: high resolution crystal structure of the histone fold dimer (nf-yb)-(nf-yc)
PDB Compounds: (A:) nuclear transcription factor y subunit beta

SCOPe Domain Sequences for d4csra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4csra_ a.22.1.3 (A:) automated matches {Homo sapiens [TaxId: 9606]}
diylpianvarimknaipqtgkiakdakecvqecvsefisfitseaserchqekrkting
edilfamstlgfdsyveplklylqkfre

SCOPe Domain Coordinates for d4csra_:

Click to download the PDB-style file with coordinates for d4csra_.
(The format of our PDB-style files is described here.)

Timeline for d4csra_: