SCOPe 2.08: Domain d4csra_: 4csr A:

Lineage for d4csra_ (4csr A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (5 families)

5. Family a.22.1.3: TBP-associated factors, TAFs [47134] (14 proteins)

6. Protein automated matches [194413] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [270229] (3 PDB entries)

8. Domain d4csra_: 4csr A: [270231]
   automated match to d4g92b_
   complexed with gol

Details for d4csra_

PDB Entry: 4csr, 1.5 Å

PDB Description: high resolution crystal structure of the histone fold dimer (nf-yb)-(nf-yc)

PDB Compounds: (A:) nuclear transcription factor y subunit beta

SCOPe Domain Sequences for d4csra_:

Sequence; same for both SEQRES and ATOM records:

>d4csra_ a.22.1.3 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diylpianvarimknaipqtgkiakdakecvqecvsefisfitseaserchqekrkting
edilfamstlgfdsyveplklylqkfre

Timeline for d4csra_:

• d4csra_ first appeared in SCOPe 2.05
  
• d4csra_ appears in SCOPe 2.07