Lineage for d4csrb_ (4csr B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2698054Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2698055Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2699133Family a.22.1.3: TBP-associated factors, TAFs [47134] (14 proteins)
  6. 2699191Protein automated matches [194413] (5 species)
    not a true protein
  7. 2699195Species Human (Homo sapiens) [TaxId:9606] [270229] (3 PDB entries)
  8. 2699197Domain d4csrb_: 4csr B: [270230]
    automated match to d1n1jb_
    complexed with gol

Details for d4csrb_

PDB Entry: 4csr (more details), 1.5 Å

PDB Description: high resolution crystal structure of the histone fold dimer (nf-yb)-(nf-yc)
PDB Compounds: (B:) nuclear transcription factor y subunit gamma

SCOPe Domain Sequences for d4csrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4csrb_ a.22.1.3 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rvqelplarikkimkldedvkmisaeapvlfakaaqifiteltlrawihtednkrrtlqr
ndiamaitkfdqfdflidivpr

SCOPe Domain Coordinates for d4csrb_:

Click to download the PDB-style file with coordinates for d4csrb_.
(The format of our PDB-style files is described here.)

Timeline for d4csrb_: