Lineage for d4cp5f_ (4cp5 F:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951070Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2951071Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. 2951072Protein Nucleoside diphosphate kinase, NDK [54921] (23 species)
  7. 2951247Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [54925] (22 PDB entries)
  8. 2951295Domain d4cp5f_: 4cp5 F: [270227]
    automated match to d1f3fa_
    complexed with eoi

Details for d4cp5f_

PDB Entry: 4cp5 (more details), 2.32 Å

PDB Description: ndpk in complex with (rp)-spmpapp
PDB Compounds: (F:) Nucleoside diphosphate kinase, cytosolic

SCOPe Domain Sequences for d4cp5f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cp5f_ d.58.6.1 (F:) Nucleoside diphosphate kinase, NDK {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
kvnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehkerpf
fgglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrniiggs
dsvesanreialwfkpeelltevkpnpnlye

SCOPe Domain Coordinates for d4cp5f_:

Click to download the PDB-style file with coordinates for d4cp5f_.
(The format of our PDB-style files is described here.)

Timeline for d4cp5f_: