SCOPe 2.06: Domain d4crza1: 4crz A:1-126

Lineage for d4crza1 (4crz A:1-126)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
   barrel, closed; n=6, S=10; complex topology with crossover (psi) loops

4. Superfamily b.52.2: ADC-like [50692] (4 families)

5. Family b.52.2.1: Pyruvoyl dependent aspartate decarboxylase, ADC [50693] (2 proteins)

6. Protein automated matches [194905] (2 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [270221] (2 PDB entries)

8. Domain d4crza1: 4crz A:1-126 [270222]
   Other proteins in same PDB: d4crza2
   automated match to d1pqfa_
   complexed with aco, mg, scn

Details for d4crza1

PDB Entry: 4crz, 1.7 Å

PDB Description: direct visualisation of strain-induced protein prost-translational modification

PDB Compounds: (A:) Aspartate 1-decarboxylase

SCOPe Domain Sequences for d4crza1:

Sequence; same for both SEQRES and ATOM records:

>d4crza1 b.52.2.1 (A:1-126) automated matches {Escherichia coli [TaxId: 83333]}
mirtmlqgklhrvkvthadlhyegscaidqdfldaagileneaidiwnvtngkrfsvyai
aaergsriisvngaaahcasvgdiviiasfvtmpdeeartwrpnvayfegdnemkrtaka
ipvqva

Timeline for d4crza1:

• d4crza1 first appeared in SCOPe 2.05, called d4crza_
  
• d4crza1 appears in SCOPe 2.07
  
• d4crza1 appears in the current release, SCOPe 2.08