| Class b: All beta proteins [48724] (180 folds) |
| Fold b.52: Double psi beta-barrel [50684] (2 superfamilies) barrel, closed; n=6, S=10; complex topology with crossover (psi) loops |
Superfamily b.52.2: ADC-like [50692] (4 families) ![]() |
| Family b.52.2.1: Pyruvoyl dependent aspartate decarboxylase, ADC [50693] (2 proteins) |
| Protein automated matches [194905] (2 species) not a true protein |
| Species Escherichia coli [TaxId:83333] [270221] (2 PDB entries) |
| Domain d4crza1: 4crz A:1-126 [270222] Other proteins in same PDB: d4crza2 automated match to d1pqfa_ complexed with aco, mg, scn |
PDB Entry: 4crz (more details), 1.7 Å
SCOPe Domain Sequences for d4crza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4crza1 b.52.2.1 (A:1-126) automated matches {Escherichia coli [TaxId: 83333]}
mirtmlqgklhrvkvthadlhyegscaidqdfldaagileneaidiwnvtngkrfsvyai
aaergsriisvngaaahcasvgdiviiasfvtmpdeeartwrpnvayfegdnemkrtaka
ipvqva
Timeline for d4crza1: