Lineage for d1at3b_ (1at3 B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2062283Fold b.57: Herpes virus serine proteinase, assemblin [50788] (1 superfamily)
    core: barrel, closed; n=7, S=8; complex topology
  4. 2062284Superfamily b.57.1: Herpes virus serine proteinase, assemblin [50789] (2 families) (S)
    automatically mapped to Pfam PF00716
  5. 2062285Family b.57.1.1: Herpes virus serine proteinase, assemblin [50790] (5 protein domains)
  6. 2062290Protein HSV-2 protease [50793] (1 species)
  7. 2062291Species Herpes simplex virus type 2 [TaxId:10310] [50794] (1 PDB entry)
  8. 2062293Domain d1at3b_: 1at3 B: [27022]
    complexed with dfp

Details for d1at3b_

PDB Entry: 1at3 (more details), 2.5 Å

PDB Description: herpes simplex virus type ii protease
PDB Compounds: (B:) herpes simplex virus type II protease

SCOPe Domain Sequences for d1at3b_:

Sequence, based on SEQRES records: (download)

>d1at3b_ b.57.1.1 (B:) HSV-2 protease {Herpes simplex virus type 2 [TaxId: 10310]}
ravpiyvagflalydsgdpgelaldpdtvraalppenplpinvdhrarcevgrvlavvnd
prgpffvgliacvqlervletaasaaiferrgpalsreerllylitnylpsvslstkrrg
devppdrtlfahvalcaigrrlgtivtydtsldaaiapfrhldpatregvrreaaeaela
lagrtwapgvealthtllstavnnmmlrdrwslvaerrrqagiaghtylqa

Sequence, based on observed residues (ATOM records): (download)

>d1at3b_ b.57.1.1 (B:) HSV-2 protease {Herpes simplex virus type 2 [TaxId: 10310]}
ravpiyvagflalydsgdpgelaldpdtvraalppenplpinvdhrarcevgrvlavvnd
prgpffvgliacvqlervletaasaailsreerllylitnylpsvslstkpdrtlfahva
lcaigrrlgtivtydtsldaaiapfrhldpatregvrreaaeaelalagrtwapgvealt
htllstavnnmmlrdrwslvaerrrqagiaghtylqa

SCOPe Domain Coordinates for d1at3b_:

Click to download the PDB-style file with coordinates for d1at3b_.
(The format of our PDB-style files is described here.)

Timeline for d1at3b_: