SCOPe 2.05: Domain d4ckwb_: 4ckw B:

Lineage for d4ckwb_ (4ckw B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (2 families)

5. Family c.23.13.1: Type II 3-dehydroquinate dehydratase [52305] (2 proteins)
   automatically mapped to Pfam PF01220

6. Protein automated matches [190071] (5 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [189947] (15 PDB entries)

8. Domain d4ckwb_: 4ckw B: [270212]
   automated match to d3n59m_
   complexed with gol; mutant

Details for d4ckwb_

PDB Entry: 4ckw, 2.7 Å

PDB Description: structure of the mycobacterium tuberculosis type ii dehydroquinase n12s mutant (crystal form 1)

PDB Compounds: (B:) 3-dehydroquinate dehydratase

SCOPe Domain Sequences for d4ckwb_:

Sequence, based on SEQRES records:

>d4ckwb_ c.23.13.1 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
elivnvingpslgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqlldw
ihqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspia
tgvivglgiqgyllalrylaehv

Sequence, based on observed residues (ATOM records):

>d4ckwb_ c.23.13.1 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
elivnvingpstthdelvaliereaaelglkavvrqsdseaqlldwihqaadaaepviln
agglthtsvalrdacaelsaplievhisnspiatgvivglgiqgyllalrylaehv

Timeline for d4ckwb_:

• d4ckwb_ is new in SCOPe 2.05-stable
  
• d4ckwb_ appears in SCOPe 2.06
  
• d4ckwb_ appears in the current release, SCOPe 2.08