Lineage for d4ckwa_ (4ckw A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2857821Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (2 families) (S)
  5. 2857822Family c.23.13.1: Type II 3-dehydroquinate dehydratase [52305] (2 proteins)
    automatically mapped to Pfam PF01220
  6. 2857936Protein automated matches [190071] (6 species)
    not a true protein
  7. 2858010Species Mycobacterium tuberculosis [TaxId:1773] [189947] (16 PDB entries)
  8. 2858233Domain d4ckwa_: 4ckw A: [270210]
    automated match to d3n59m_
    complexed with gol; mutant

Details for d4ckwa_

PDB Entry: 4ckw (more details), 2.7 Å

PDB Description: structure of the mycobacterium tuberculosis type ii dehydroquinase n12s mutant (crystal form 1)
PDB Compounds: (A:) 3-dehydroquinate dehydratase

SCOPe Domain Sequences for d4ckwa_:

Sequence, based on SEQRES records: (download)

>d4ckwa_ c.23.13.1 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
livnvingpslgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqlldwi
hqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiat
gvivglgiqgyllalrylaehlg

Sequence, based on observed residues (ATOM records): (download)

>d4ckwa_ c.23.13.1 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
livnvingpshdelvaliereaaelglkavvrqsdseaqlldwihqaadaaepvilnagg
lthtsvalrdacaelsaplievhisnvspiatgvivglgiqgyllalrylaehlg

SCOPe Domain Coordinates for d4ckwa_:

Click to download the PDB-style file with coordinates for d4ckwa_.
(The format of our PDB-style files is described here.)

Timeline for d4ckwa_: