Lineage for d5ajma_ (5ajm A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1778087Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1778088Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 1778135Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 1778497Protein automated matches [190291] (24 species)
    not a true protein
  7. 1778569Species Influenza a virus (a/vietnam/1194/2004(h5n1)) [TaxId:644788] [228150] (10 PDB entries)
  8. 1778576Domain d5ajma_: 5ajm A: [270205]
    Other proteins in same PDB: d5ajmb_
    automated match to d1rd8a_
    complexed with mpo, nag; mutant

Details for d5ajma_

PDB Entry: 5ajm (more details), 2.45 Å

PDB Description: h5 (vn1194) asn186lys mutant haemagglutinin in complex with avian receptor analogue 3'sln
PDB Compounds: (A:) haemagglutinin ha1

SCOPe Domain Sequences for d5ajma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ajma_ b.19.1.2 (A:) automated matches {Influenza a virus (a/vietnam/1194/2004(h5n1)) [TaxId: 644788]}
dqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsvagw
llgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipks
swssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlwgihh
pkdaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpndain
fesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpltig
ecpkyvksnrlvlatglrnsp

SCOPe Domain Coordinates for d5ajma_:

Click to download the PDB-style file with coordinates for d5ajma_.
(The format of our PDB-style files is described here.)

Timeline for d5ajma_: