Lineage for d5ajmb_ (5ajm B:)

  1. Root: SCOPe 2.05
  2. 1968223Class h: Coiled coil proteins [57942] (7 folds)
  3. 1969577Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 1969578Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 1969579Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 1969953Protein automated matches [254646] (33 species)
    not a true protein
  7. 1970022Species Influenza a virus (a/vietnam/1194/2004(h5n1)) [TaxId:644788] [256672] (9 PDB entries)
  8. 1970029Domain d5ajmb_: 5ajm B: [270204]
    Other proteins in same PDB: d5ajma_
    automated match to d2fk0b1
    complexed with mpo, nag; mutant

Details for d5ajmb_

PDB Entry: 5ajm (more details), 2.45 Å

PDB Description: h5 (vn1194) asn186lys mutant haemagglutinin in complex with avian receptor analogue 3'sln
PDB Compounds: (B:) haemagglutinin ha2

SCOPe Domain Sequences for d5ajmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ajmb_ h.3.1.1 (B:) automated matches {Influenza a virus (a/vietnam/1194/2004(h5n1)) [TaxId: 644788]}
glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqy

SCOPe Domain Coordinates for d5ajmb_:

Click to download the PDB-style file with coordinates for d5ajmb_.
(The format of our PDB-style files is described here.)

Timeline for d5ajmb_: