Lineage for d5af5a_ (5af5 A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1892544Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1892545Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1892546Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 1893246Protein automated matches [190118] (9 species)
    not a true protein
  7. 1893271Species Human (Homo sapiens) [TaxId:9606] [189560] (79 PDB entries)
  8. 1893309Domain d5af5a_: 5af5 A: [270196]
    automated match to d3rula_

Details for d5af5a_

PDB Entry: 5af5 (more details), 1.68 Å

PDB Description: structure of lys33-linked triub s.g. p 212121
PDB Compounds: (A:) Polyubiquitin-C

SCOPe Domain Sequences for d5af5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5af5a_ d.15.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mqifvktltgrtitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
iqkestlhlvlrl

SCOPe Domain Coordinates for d5af5a_:

Click to download the PDB-style file with coordinates for d5af5a_.
(The format of our PDB-style files is described here.)

Timeline for d5af5a_: