Lineage for d5af4g_ (5af4 G:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2931198Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2932413Protein automated matches [190118] (16 species)
    not a true protein
  7. 2932448Species Human (Homo sapiens) [TaxId:9606] [189560] (113 PDB entries)
  8. 2932526Domain d5af4g_: 5af4 G: [270191]
    automated match to d2murb_
    complexed with gol, so4

Details for d5af4g_

PDB Entry: 5af4 (more details), 1.85 Å

PDB Description: structure of lys33-linked diub
PDB Compounds: (G:) Ubiquitin

SCOPe Domain Sequences for d5af4g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5af4g_ d.15.1.1 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mqifvktltgrtitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
iqkestlhlvlrl

SCOPe Domain Coordinates for d5af4g_:

Click to download the PDB-style file with coordinates for d5af4g_.
(The format of our PDB-style files is described here.)

Timeline for d5af4g_: