Lineage for d4xyfa_ (4xyf A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2218047Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2218048Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2218179Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2219750Protein Hepatocyte growth factor receptor, c-MET [103300] (1 species)
    PTK group; HGFR subfamily; membrane spanning protein tyrosine kinase
  7. 2219751Species Human (Homo sapiens) [TaxId:9606] [103301] (52 PDB entries)
  8. 2219784Domain d4xyfa_: 4xyf A: [270189]
    automated match to d4iwda_
    complexed with 44x

Details for d4xyfa_

PDB Entry: 4xyf (more details), 1.85 Å

PDB Description: crystal structure of c-met in complex with (s)-5-(8-fluoro-3-(1-(3-(2- methoxyethoxy)quinolin-6-yl)ethyl)-[1,2,4]triazolo[4,3-a]pyridin-6- yl)-3-methylisoxazole
PDB Compounds: (A:) Hepatocyte growth factor receptor

SCOPe Domain Sequences for d4xyfa_:

Sequence, based on SEQRES records: (download)

>d4xyfa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]}
hidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkihcavks
lnritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnfirn
ethnptvkdligfglqvakgmkylaskkfvhrdlaarncmldekftvkvadfglardmyd
keyysvhnktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdvntfd
itvyllqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfig

Sequence, based on observed residues (ATOM records): (download)

>d4xyfa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]}
hidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtllkihcavkslnrit
digevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnfirnethnp
tvkdligfglqvakgmkylaskkfvhrdlaarncmldekftvkvadfglardmydkeyys
vhnktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdvntfditvyl
lqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfig

SCOPe Domain Coordinates for d4xyfa_:

Click to download the PDB-style file with coordinates for d4xyfa_.
(The format of our PDB-style files is described here.)

Timeline for d4xyfa_: