Lineage for d4yf2c_ (4yf2 C:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2531350Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2531351Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2533682Family d.2.1.0: automated matches [191411] (1 protein)
    not a true family
  6. 2533683Protein automated matches [190563] (18 species)
    not a true protein
  7. 2533714Species Mouse (Mus musculus) [TaxId:10090] [187760] (1 PDB entry)
  8. 2533717Domain d4yf2c_: 4yf2 C: [270188]
    Other proteins in same PDB: d4yf2a2
    automated match to d1lsga1

Details for d4yf2c_

PDB Entry: 4yf2 (more details), 2.15 Å

PDB Description: crystal structure of mouse sperm c-type lysozyme-like protein 1
PDB Compounds: (C:) Sperm acrosome membrane-associated protein 3

SCOPe Domain Sequences for d4yf2c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yf2c_ d.2.1.0 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
akvfsrcelakemhdfgldgyrgynladwvclayytsgfntnavdheadgstnngifqis
srrwcrtlasngpnlcriyctdllnndlkdsivcamkivqeplglgyweawrhhcqgrdl
sdwvdgc

SCOPe Domain Coordinates for d4yf2c_:

Click to download the PDB-style file with coordinates for d4yf2c_.
(The format of our PDB-style files is described here.)

Timeline for d4yf2c_: