Lineage for d4yfsa_ (4yfs A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2016272Fold a.264: Duffy binding domain-like [140923] (1 superfamily)
    consist of two subdomains, each containing a three-helical bundle
  4. 2016273Superfamily a.264.1: Duffy binding domain-like [140924] (2 families) (S)
    automatically mapped to Pfam PF05424
  5. 2016274Family a.264.1.1: Duffy binding domain [140925] (3 protein domains)
    Pfam PF05424
  6. 2016286Protein automated matches [191262] (2 species)
    not a true protein
  7. 2016287Species Plasmodium vivax [TaxId:126793] [189825] (4 PDB entries)
  8. 2016292Domain d4yfsa_: 4yfs A: [270186]
    automated match to d4nuub_

Details for d4yfsa_

PDB Entry: 4yfs (more details), 2.1 Å

PDB Description: structure of the synthetic duffy binding protein (dbp) antigen deknull relevant for malaria vaccine design
PDB Compounds: (A:) Duffy receptor

SCOPe Domain Sequences for d4yfsa_:

Sequence, based on SEQRES records: (download)

>d4yfsa_ a.264.1.1 (A:) automated matches {Plasmodium vivax [TaxId: 126793]}
kncnykrkrrerdwdcntkkdvcipdrryqlcmkeltnlvnntdtnfhrditfrklylkr
kliydaavegdlllklnnyrynkdfckdirwslgdfgdiimgtdmegigyskvvennlrs
ifgtastaatsrtswwneskaqiwtammysvkkrlkgnfiwicklnvavniepqiyrwir
ewgrdyvselptevqklkekcdgkinytdkkvckvppcqnacksydqwitrkknqwdvls
nkfisvknaekvqtagivtpydilkqeldefnevafeneinkrdgayielcvcs

Sequence, based on observed residues (ATOM records): (download)

>d4yfsa_ a.264.1.1 (A:) automated matches {Plasmodium vivax [TaxId: 126793]}
kncnykrkrrerdwdcntkkdvcipdrryqlcmkeltnlhrditfrklylkrkliydaav
egdlllklnnyrynkdfckdirwslgdfgdiimgtdmegigyskvvennlrsifgtasta
atsrtswwneskaqiwtammysvkkrlkgnfiwicklnvavniepqiyrwirewgrdyvs
elptevqklkekcdgkinytdkkvckvppcqnacksydqwitrkknqwdvlsnkfisvkn
aekvqtaivtpydilkqeldefnevafeneinkrdgayielcvcs

SCOPe Domain Coordinates for d4yfsa_:

Click to download the PDB-style file with coordinates for d4yfsa_.
(The format of our PDB-style files is described here.)

Timeline for d4yfsa_: