Lineage for d4yduc2 (4ydu C:108-230)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137193Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2137194Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2138437Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 2138438Protein automated matches [226839] (52 species)
    not a true protein
  7. 2138537Species Escherichia coli [TaxId:562] [270176] (2 PDB entries)
  8. 2138539Domain d4yduc2: 4ydu C:108-230 [270178]
    automated match to d2gema2
    complexed with act, adp, fe, mg

Details for d4yduc2

PDB Entry: 4ydu (more details), 2.33 Å

PDB Description: crystal structure of e. coli ygjd-yeaz heterodimer in complex with adp
PDB Compounds: (C:) tRNA threonylcarbamoyladenosine biosynthesis protein tsab

SCOPe Domain Sequences for d4yduc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yduc2 c.55.1.0 (C:108-230) automated matches {Escherichia coli [TaxId: 562]}
atrvlaaidarmgevywaeyqrdengiwhgeeteavlkpeivhermqqlsgewvtvgtgw
qawpdlgkesglvlrdgevllpaaedmlpiacqmfaegktvavehaepvylrnnvawkkl
pgk

SCOPe Domain Coordinates for d4yduc2:

Click to download the PDB-style file with coordinates for d4yduc2.
(The format of our PDB-style files is described here.)

Timeline for d4yduc2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4yduc1