| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
| Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
| Protein automated matches [226839] (64 species) not a true protein |
| Species Escherichia coli [TaxId:562] [270176] (3 PDB entries) |
| Domain d4yduc2: 4ydu C:108-230 [270178] automated match to d2gema2 complexed with act, adp, fe, mg |
PDB Entry: 4ydu (more details), 2.33 Å
SCOPe Domain Sequences for d4yduc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4yduc2 c.55.1.0 (C:108-230) automated matches {Escherichia coli [TaxId: 562]}
atrvlaaidarmgevywaeyqrdengiwhgeeteavlkpeivhermqqlsgewvtvgtgw
qawpdlgkesglvlrdgevllpaaedmlpiacqmfaegktvavehaepvylrnnvawkkl
pgk
Timeline for d4yduc2: