SCOPe 2.05: Domain d4yduc1: 4ydu C:1-107

Lineage for d4yduc1 (4ydu C:1-107)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (49 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [270176] (1 PDB entry)

8. Domain d4yduc1: 4ydu C:1-107 [270177]
   automated match to d3zeua1
   complexed with act, adp, fe, mg

Details for d4yduc1

PDB Entry: 4ydu, 2.33 Å

PDB Description: crystal structure of e. coli ygjd-yeaz heterodimer in complex with adp

PDB Compounds: (C:) tRNA threonylcarbamoyladenosine biosynthesis protein tsab

SCOPe Domain Sequences for d4yduc1:

Sequence; same for both SEQRES and ATOM records:

>d4yduc1 c.55.1.0 (C:1-107) automated matches {Escherichia coli [TaxId: 562]}
mrilaidtateacsvalwndgtvnahfelcprehtqrilpmvqdilttsgtsltdinala
ygrgpgsftgvrigigiaqglalgaelpmigvstlmtmaqgawrkng

Timeline for d4yduc1:

• d4yduc1 is new in SCOPe 2.05-stable
  
• d4yduc1 appears in SCOPe 2.06
  
• d4yduc1 appears in the current release, SCOPe 2.08