Lineage for d4xt1c_ (4xt1 C:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1755448Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1757949Protein automated matches [190119] (18 species)
    not a true protein
  7. 1758808Species Vicugna pacos [TaxId:30538] [189756] (9 PDB entries)
  8. 1758821Domain d4xt1c_: 4xt1 C: [270175]
    Other proteins in same PDB: d4xt1b_
    automated match to d4kfzd_
    complexed with clr, olc, sin, unl

Details for d4xt1c_

PDB Entry: 4xt1 (more details), 2.89 Å

PDB Description: structure of a nanobody-bound viral gpcr bound to human chemokine cx3cl1
PDB Compounds: (C:) nanobody 7

SCOPe Domain Sequences for d4xt1c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xt1c_ b.1.1.1 (C:) automated matches {Vicugna pacos [TaxId: 30538]}
qvqlvesggglvrpggslrlscaasgsiftiyamgwyrqapgkqrelvaritfggdtnya
dsvkgrftisrdnaknavylqmnslkpedtavyycnaeetiveeadywgqgtqvtv

SCOPe Domain Coordinates for d4xt1c_:

Click to download the PDB-style file with coordinates for d4xt1c_.
(The format of our PDB-style files is described here.)

Timeline for d4xt1c_: