SCOPe 2.08: Domain d4xt1c1: 4xt1 C:14-116

Lineage for d4xt1c1 (4xt1 C:14-116)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Vicugna pacos [TaxId:30538] [189756] (82 PDB entries)

8. Domain d4xt1c1: 4xt1 C:14-116 [270175]
   Other proteins in same PDB: d4xt1b_, d4xt1c2
   automated match to d4kfzd_
   complexed with clr, olc, sin, unl

Details for d4xt1c1

PDB Entry: 4xt1, 2.89 Å

PDB Description: structure of a nanobody-bound viral gpcr bound to human chemokine cx3cl1

PDB Compounds: (C:) nanobody 7

SCOPe Domain Sequences for d4xt1c1:

Sequence; same for both SEQRES and ATOM records:

>d4xt1c1 b.1.1.1 (C:14-116) automated matches {Vicugna pacos [TaxId: 30538]}
pggslrlscaasgsiftiyamgwyrqapgkqrelvaritfggdtnyadsvkgrftisrdn
aknavylqmnslkpedtavyycnaeetiveeadywgqgtqvtv

Timeline for d4xt1c1:

• d4xt1c1 first appeared in SCOPe 2.05, called d4xt1c_
  
• d4xt1c1 was called d4xt1c_ in SCOPe 2.07