Lineage for d4y0vb_ (4y0v B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2110099Family c.37.1.8: G proteins [52592] (79 protein domains)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2111131Protein automated matches [190047] (28 species)
    not a true protein
  7. 2111167Species Entamoeba (Entamoeba histolytica) [TaxId:5759] [196360] (4 PDB entries)
  8. 2111173Domain d4y0vb_: 4y0v B: [270168]
    automated match to d2x77b_
    complexed with gdp, mg

Details for d4y0vb_

PDB Entry: 4y0v (more details), 1.8 Å

PDB Description: structure of an adp ribosylation factor from entamoeba histolytica hm- 1:imss bound to mg-gdp
PDB Compounds: (B:) ADP-ribosylation factor 1

SCOPe Domain Sequences for d4y0vb_:

Sequence, based on SEQRES records: (download)

>d4y0vb_ c.37.1.8 (B:) automated matches {Entamoeba (Entamoeba histolytica) [TaxId: 5759]}
swlskllgkkemrilmvgldaagktsilyklklgeivttiptigfnvetveyknisftvw
dvggqdkirplwrhyyqntqaiifvvdsndrdrigeareelmkmlnedemrnaillvfan
khdlpqamsisevteklglqtiknrkwycqtscatngdglyegldwladnl

Sequence, based on observed residues (ATOM records): (download)

>d4y0vb_ c.37.1.8 (B:) automated matches {Entamoeba (Entamoeba histolytica) [TaxId: 5759]}
swlskllgkkemrilmvgldaagktsilyklklgeivttiptigfnvetveyknisftvw
dvggyyqntqaiifvvdsndrdrigeareelmkmlnedemrnaillvfankhdlpqamsi
sevteklglqtiknrkwycqtscatngdglyegldwladnl

SCOPe Domain Coordinates for d4y0vb_:

Click to download the PDB-style file with coordinates for d4y0vb_.
(The format of our PDB-style files is described here.)

Timeline for d4y0vb_: