SCOPe 2.08: Domain d4xl8a_: 4xl8 A:

Lineage for d4xl8a_ (4xl8 A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
   sandwich, 10 strands in 2 sheets; greek-key

4. Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families)

5. Family b.21.1.0: automated matches [191353] (1 protein)
   not a true family

6. Protein automated matches [190378] (9 species)
   not a true protein

7. Species Human adenovirus 52 [TaxId:332179] [270156] (2 PDB entries)

8. Domain d4xl8a_: 4xl8 A: [270158]
   automated match to d4k6ta_
   complexed with ala, glu, gol, mna, mpd, mrd, tam

Details for d4xl8a_

PDB Entry: 4xl8, 1.65 Å

PDB Description: crystal structure of human adenovirus 52 short fiber knob in complex with 2-o-methyl-5-n-acetylneuraminic acid

PDB Compounds: (A:) Fiber-1

SCOPe Domain Sequences for d4xl8a_:

Sequence; same for both SEQRES and ATOM records:

>d4xl8a_ b.21.1.0 (A:) automated matches {Human adenovirus 52 [TaxId: 332179]}
giqtlwtpptsnpnctvytesdsllslcltkcgahvlgsvsltgvagtmtnmaetslaie
ftfddtgkllhsplvnntfsirqgdspasnptynalafmpnstlyarggsgeprnnyyvq
tylrgnvqrpitltvtfnsaatgyslsfkwtavvrekfaapatsfcyiteq

Timeline for d4xl8a_:

• d4xl8a_ first appeared in SCOPe 2.05
  
• d4xl8a_ appears in SCOPe 2.07