Lineage for d4xl8b_ (4xl8 B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2041113Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
    sandwich, 10 strands in 2 sheets; greek-key
  4. 2041114Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) (S)
  5. 2041329Family b.21.1.0: automated matches [191353] (1 protein)
    not a true family
  6. 2041330Protein automated matches [190378] (6 species)
    not a true protein
  7. 2041359Species Human adenovirus 52 [TaxId:332179] [270156] (1 PDB entry)
  8. 2041361Domain d4xl8b_: 4xl8 B: [270157]
    automated match to d4k6ta_
    complexed with ala, glu, gol, mna, mpd, mrd, tam

Details for d4xl8b_

PDB Entry: 4xl8 (more details), 1.65 Å

PDB Description: crystal structure of human adenovirus 52 short fiber knob in complex with 2-o-methyl-5-n-acetylneuraminic acid
PDB Compounds: (B:) Fiber-1

SCOPe Domain Sequences for d4xl8b_:

Sequence, based on SEQRES records: (download)

>d4xl8b_ b.21.1.0 (B:) automated matches {Human adenovirus 52 [TaxId: 332179]}
iqtlwtpptsnpnctvytesdsllslcltkcgahvlgsvsltgvagtmtnmaetslaief
tfddtgkllhsplvnntfsirqgdspasnptynalafmpnstlyarggsgeprnnyyvqt
ylrgnvqrpitltvtfnsaatgyslsfkwtavvrekfaapatsfcyiteq

Sequence, based on observed residues (ATOM records): (download)

>d4xl8b_ b.21.1.0 (B:) automated matches {Human adenovirus 52 [TaxId: 332179]}
iqtlwtpptsnpnctvytesdsllslcltkcgahvlgsvsltgvagtmtnmaetslaief
tfddtgkllhsplvnntfsirqynalafmpnstlyarggsgeprnnyyvqtylrgnvqrp
itltvtfnsaatgyslsfkwtavvrekfaapatsfcyiteq

SCOPe Domain Coordinates for d4xl8b_:

Click to download the PDB-style file with coordinates for d4xl8b_.
(The format of our PDB-style files is described here.)

Timeline for d4xl8b_: