Lineage for d4xjqb_ (4xjq B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2064980Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2064981Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2064982Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 protein domains)
  6. 2065266Protein automated matches [193245] (14 species)
    not a true protein
  7. 2065275Species Human parainfluenza virus 3 [TaxId:11216] [270133] (5 PDB entries)
  8. 2065277Domain d4xjqb_: 4xjq B: [270147]
    automated match to d4mzab_
    complexed with bma, ca, edo, gol, man, nag, so4

Details for d4xjqb_

PDB Entry: 4xjq (more details), 1.9 Å

PDB Description: the catalytic mechanism of human parainfluenza virus type 3 haemagglutinin-neuraminidase revealed
PDB Compounds: (B:) hemagglutinin-neuraminidase

SCOPe Domain Sequences for d4xjqb_:

Sequence, based on SEQRES records: (download)

>d4xjqb_ b.68.1.1 (B:) automated matches {Human parainfluenza virus 3 [TaxId: 11216]}
vppqrithdvgikplnpddfwrctsglpslmktpkirlmpgpgllampttvdgcvrtpsl
vindliyaytsnlitrgcqdigksyqvlqigiitvnsdlvpdlnprishtfnindnrksc
slallntdvyqlcstpkvdersdyassgiedivldivnhdgsisttrfknnnisfdqpya
alypsvgpgiyykgkiiflgygglehpinenaicnttgcpgktqrdcnqashspwfsdrr
mvnsiivvdkglnsipklkvwtismrqnywgsegrllllgnkiyiytrstswhsklqlgi
iditdysdirikwtwhnvlsrpgnnecpwghscpdgcitgvytdayplnptgsivssvil
dsqksrvnpvitystatervnelairnktlsagytttscithynkgycfhiveinhksld
tfqpmlfkteipkscs

Sequence, based on observed residues (ATOM records): (download)

>d4xjqb_ b.68.1.1 (B:) automated matches {Human parainfluenza virus 3 [TaxId: 11216]}
vppqrithdvgikplnpddfwrctsglpslmktpkirlmpgpgllampttvdgcvrtpsl
vindliyaytsnlitrgcqdigksyqvlqigiitvnsdlvpdlnprishtfnindnrksc
slallntdvyqlcstpkvdersdyassgiedivldivnhdgsisttrfknnnisfdqpya
alypsvgpgiyykgkiiflgygglehpinenaicnttgcpgktqrdcnqashspwfsdrr
mvnsiivvdkgsipklkvwtismrqnywgsegrllllgnkiyiytrstswhsklqlgiid
itdysdirikwtwhnvlsrpgnnecpwghscpdgcitgvytdayplnptgsivssvilds
qksrvnpvitystatervnelairnktlsagytttscithynkgycfhiveinhksldtf
qpmlfkteipkscs

SCOPe Domain Coordinates for d4xjqb_:

Click to download the PDB-style file with coordinates for d4xjqb_.
(The format of our PDB-style files is described here.)

Timeline for d4xjqb_: