Lineage for d4xixf_ (4xix F:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1804997Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 1804998Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 1805718Family b.74.1.0: automated matches [191576] (1 protein)
    not a true family
  6. 1805719Protein automated matches [191011] (12 species)
    not a true protein
  7. 1805720Species Chlamydomonas reinhardtii [TaxId:3055] [270125] (2 PDB entries)
  8. 1805734Domain d4xixf_: 4xix F: [270137]
    automated match to d3mdza_
    complexed with 2hp, zn

Details for d4xixf_

PDB Entry: 4xix (more details), 2.7 Å

PDB Description: carbonic anhydrase cah3 from chlamydomonas reinhardtii in complex with phosphate.
PDB Compounds: (F:) Carbonic anhydrase, alpha type

SCOPe Domain Sequences for d4xixf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xixf_ b.74.1.0 (F:) automated matches {Chlamydomonas reinhardtii [TaxId: 3055]}
aawnygevagpptwkgvcatgkrqspiniplntsapkvdaemgefdfaygsfekcdvlnt
ghgtmqvnfpagnlafignmelellqfhfhapsehamdgrryameahlvhknkstgnlav
lgimlepggliknpalstalevapevplakkpspkginpvmllpkkskagtrpfvhypgs
lttppcsegvdwfvfmqpikvpdsqildfmrfvgdnktyatntrplqllnsrlveyel

SCOPe Domain Coordinates for d4xixf_:

Click to download the PDB-style file with coordinates for d4xixf_.
(The format of our PDB-style files is described here.)

Timeline for d4xixf_: