Lineage for d4xjrb_ (4xjr B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1802176Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 1802177Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 1802178Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins)
  6. 1802440Protein automated matches [193245] (15 species)
    not a true protein
  7. 1802449Species Human parainfluenza virus 3 [TaxId:11216] [270133] (3 PDB entries)
  8. 1802455Domain d4xjrb_: 4xjr B: [270135]
    automated match to d4mzab_
    complexed with ca, edo, nag, oel, so4

Details for d4xjrb_

PDB Entry: 4xjr (more details), 3 Å

PDB Description: the catalytic mechanism of human parainfluenza virus type 3 haemagglutinin-neuraminidase revealed
PDB Compounds: (B:) hemagglutinin-neuraminidase

SCOPe Domain Sequences for d4xjrb_:

Sequence, based on SEQRES records: (download)

>d4xjrb_ b.68.1.1 (B:) automated matches {Human parainfluenza virus 3 [TaxId: 11216]}
ithdvgikplnpddfwrctsglpslmktpkirlmpgpgllampttvdgcvrtpslvindl
iyaytsnlitrgcqdigksyqvlqigiitvnsdlvpdlnprishtfnindnrkscslall
ntdvyqlcstpkvdersdyassgiedivldivnhdgsisttrfknnnisfdqpyaalyps
vgpgiyykgkiiflgygglehpinenaicnttgcpgktqrdcnqashspwfsdrrmvnsi
ivvdkglnsipklkvwtismrqnywgsegrllllgnkiyiytrstswhsklqlgiiditd
ysdirikwtwhnvlsrpgnnecpwghscpdgcitgvytdayplnptgsivssvildsqks
rvnpvitystatervnelairnktlsagytttscithynkgycfhiveinhksldtfqpm
lfkteipksc

Sequence, based on observed residues (ATOM records): (download)

>d4xjrb_ b.68.1.1 (B:) automated matches {Human parainfluenza virus 3 [TaxId: 11216]}
ithdvgikplnpddfwrctsglpslmktpkirlmpgpgllampttvdgcvrtpslvindl
iyaytsnlitrgcqdigksyqvlqigiitvnsdlvpdlnprishtfnindnrkscslall
ntdvyqlcstpkvdersdyassgiedivldivnhdgsisttrfknnnisfdqpyaalyps
vgpgiyykgkiiflgygglehpinenaicnttgcpgktqrdcnqashspwfsdrrmvnsi
ivvdsipklkvwtismrqnywgsegrllllgnkiyiytrstswhsklqlgiiditdysdi
rikwtwhnvlsrpgnnecpwghscpdgcitgvytdayplnptgsivssvildsqksrvnp
vitystatervnelairnktlsagytttscithynkgycfhiveinhksldtfqpmlfkt
eipksc

SCOPe Domain Coordinates for d4xjrb_:

Click to download the PDB-style file with coordinates for d4xjrb_.
(The format of our PDB-style files is described here.)

Timeline for d4xjrb_: