![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies) consists of six 4-stranded beta-sheet motifs; meander |
![]() | Superfamily b.68.1: Sialidases [50939] (3 families) ![]() |
![]() | Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins) |
![]() | Protein automated matches [193245] (14 species) not a true protein |
![]() | Species Human parainfluenza virus 3 [TaxId:11216] [270133] (5 PDB entries) |
![]() | Domain d4xjqa_: 4xjq A: [270134] automated match to d4mzab_ complexed with bma, ca, edo, gol, man, nag, so4 |
PDB Entry: 4xjq (more details), 1.9 Å
SCOPe Domain Sequences for d4xjqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xjqa_ b.68.1.1 (A:) automated matches {Human parainfluenza virus 3 [TaxId: 11216]} rithdvgikplnpddfwrctsglpslmktpkirlmpgpgllampttvdgcvrtpslvind liyaytsnlitrgcqdigksyqvlqigiitvnsdlvpdlnprishtfnindnrkscslal lntdvyqlcstpkvdersdyassgiedivldivnhdgsisttrfknnnisfdqpyaalyp svgpgiyykgkiiflgygglehpinenaicnttgcpgktqrdcnqashspwfsdrrmvns iivvdkglnsipklkvwtismrqnywgsegrllllgnkiyiytrstswhsklqlgiidit dysdirikwtwhnvlsrpgnnecpwghscpdgcitgvytdayplnptgsivssvildsqk srvnpvitystatervnelairnktlsagytttscithynkgycfhiveinhksldtfqp mlfkteipkscs
Timeline for d4xjqa_: