Lineage for d4xixd_ (4xix D:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1804997Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 1804998Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 1805718Family b.74.1.0: automated matches [191576] (1 protein)
    not a true family
  6. 1805719Protein automated matches [191011] (12 species)
    not a true protein
  7. 1805720Species Chlamydomonas reinhardtii [TaxId:3055] [270125] (2 PDB entries)
  8. 1805732Domain d4xixd_: 4xix D: [270126]
    automated match to d3mdza_
    complexed with 2hp, zn

Details for d4xixd_

PDB Entry: 4xix (more details), 2.7 Å

PDB Description: carbonic anhydrase cah3 from chlamydomonas reinhardtii in complex with phosphate.
PDB Compounds: (D:) Carbonic anhydrase, alpha type

SCOPe Domain Sequences for d4xixd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xixd_ b.74.1.0 (D:) automated matches {Chlamydomonas reinhardtii [TaxId: 3055]}
awnygevagpptwkgvcatgkrqspiniplntsapkvdaemgefdfaygsfekcdvlntg
hgtmqvnfpagnlafignmelellqfhfhapsehamdgrryameahlvhknkstgnlavl
gimlepggliknpalstalevapevplakkpspkginpvmllpkkskagtrpfvhypgsl
ttppcsegvdwfvfmqpikvpdsqildfmrfvgdnktyatntrplqllnsrlveyel

SCOPe Domain Coordinates for d4xixd_:

Click to download the PDB-style file with coordinates for d4xixd_.
(The format of our PDB-style files is described here.)

Timeline for d4xixd_: