Lineage for d4xdad_ (4xda D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2904325Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2904326Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 2904617Family c.72.1.0: automated matches [191321] (1 protein)
    not a true family
  6. 2904618Protein automated matches [190117] (50 species)
    not a true protein
  7. 2904975Species Vibrio cholerae [TaxId:345073] [269172] (7 PDB entries)
  8. 2904982Domain d4xdad_: 4xda D: [270124]
    automated match to d1rk2b_
    complexed with adp, na, rib

Details for d4xdad_

PDB Entry: 4xda (more details), 1.75 Å

PDB Description: vibrio cholerae o395 ribokinase complexed with ribose, adp and sodium ion.
PDB Compounds: (D:) ribokinase

SCOPe Domain Sequences for d4xdad_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xdad_ c.72.1.0 (D:) automated matches {Vibrio cholerae [TaxId: 345073]}
mnklvvlgsvnadhvlqvpsfprpgetlhgrnyqvipggkganqavaaarmqadvgfiac
vgddsfginiresfkldgintagvklqpncptgiamiqvsdsgensicisaeanakltaa
aiepdlaairdaryllmqletpldgilkaaqeaktaktnvilnpaparelpdellkcvdl
itpneteaevltgitvyddssaqqaadalhckgieiviitlgskgvwlsqngrgqripgf
vvkatdttaagdtfngalvtgllqemplesaikfahaaaaisvtrfgaqtsiptraevea
flaehs

SCOPe Domain Coordinates for d4xdad_:

Click to download the PDB-style file with coordinates for d4xdad_.
(The format of our PDB-style files is described here.)

Timeline for d4xdad_: