Lineage for d4xdab_ (4xda B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1872415Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 1872416Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 1872643Family c.72.1.0: automated matches [191321] (1 protein)
    not a true family
  6. 1872644Protein automated matches [190117] (37 species)
    not a true protein
  7. 1872895Species Vibrio cholerae [TaxId:345073] [269172] (2 PDB entries)
  8. 1872897Domain d4xdab_: 4xda B: [270121]
    automated match to d1rk2b_
    complexed with adp, na, rib

Details for d4xdab_

PDB Entry: 4xda (more details), 1.75 Å

PDB Description: vibrio cholerae o395 ribokinase complexed with ribose, adp and sodium ion.
PDB Compounds: (B:) ribokinase

SCOPe Domain Sequences for d4xdab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xdab_ c.72.1.0 (B:) automated matches {Vibrio cholerae [TaxId: 345073]}
mnklvvlgsvnadhvlqvpsfprpgetlhgrnyqvipggkganqavaaarmqadvgfiac
vgddsfginiresfkldgintagvklqpncptgiamiqvsdsgensicisaeanakltaa
aiepdlaairdaryllmqletpldgilkaaqeaktaktnvilnpaparelpdellkcvdl
itpneteaevltgitvyddssaqqaadalhckgieiviitlgskgvwlsqngrgqripgf
vvkatdttaagdtfngalvtgllqemplesaikfahaaaaisvtrfgaqtsiptraevea
flaehs

SCOPe Domain Coordinates for d4xdab_:

Click to download the PDB-style file with coordinates for d4xdab_.
(The format of our PDB-style files is described here.)

Timeline for d4xdab_: